HORDB

ID: hor005655
Uniprot ID: P01298
Protein name: Pancreatic hormone
Gene name: PPY
Organism: Homo sapiens (Human)
Family: NPY family
Source: Human
Expression: NA
Disease: Diseases associated with PPY include Non-Functioning Pancreatic Endocrine Tumor and Auditory System Cancer.
Comments: Obinepitide is under clinical trial by 7TM Pharma to be used for the treatment of obesity. Obinepitide is derived from pancreatic hormone by having Gln-63
Taxonomy: Homo (genus), Homininae (subfamily), Hominidae (family), Hominoidea (superfamily), Catarrhini (parvorder), Simiiformes (infraorder), Haplorrhini (suborder), Primates (order), Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0001664 G protein-coupled receptor binding; GO:0005179 hormone activity; GO:0005184 neuropeptide hormone activity; GO:0005515 protein binding; GO:0031841 neuropeptide Y receptor binding
GO BP: GO:0007218 neuropeptide signaling pathway; GO:0007631 feeding behavior; GO:0009306 protein secretion
GO CC: GO:0005576 extracellular region; GO:0005615 extracellular space; GO:0005737 cytoplasm

Sequence: APLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRY
Length: 36
Propeptide: MAAARLCLSLLLLSTCVALLLQPLLGAQGAPLEPVYPGDNATPEQMAQYAADLRRYINMLTRPRYGKRHKEDTLAFSEWGSPHAAVPRELSPLDL
Signal peptide: MAAARLCLSLLLLSTCVALLLQPLLGAQG
Modification: T36 Tyrosine amide
Glycosylation: NA
Mutagenesis: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor005655_AF2.pdb

hor005655_ESM.pdb

Mass:	480721	Formula:	C185H286N52O55S2
Absent amino acids:	CFHKSW	Common amino acids:	AP
pI:	6.6	Basic residues:	4
Polar residues:	9	Hydrophobic residues:	10
Hydrophobicity:	-78.06	Boman Index:	-8239
Half-Life:	4.4 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	>10 hour	Aliphatic Index	65.28
Instability Index:	6316.39	Extinction Coefficient cystines:	5960
Absorbance 280nm:	170.29